PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G061400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family B3
Protein Properties Length: 370aa    MW: 41737.3 Da    PI: 9.2695
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G061400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3391.4e-12275358186
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         ++k++++  + +++ l+lp  f++++g+ +++s+tl+   +s  sW+ ++i   +s+++v  +G k+F ++ g+k+gD+++F  ++
  Sevir.7G061400.1.p 275 WVKKEINTCAIQNNTLYLPPVFCKAIGIWEPCSITLKTSMSSTTSWQARVIPYDHSSHHV--NGLKRFYQDSGIKVGDVCTFIIIE 358
                         68999999999**********************9999999999*******7666666665..8*******************8654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.7E-1467168IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-1669168IPR015300DNA-binding pseudobarrel domain
CDDcd100171.58E-870163No hitNo description
SMARTSM010190.003472166IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-13271366IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.93276369IPR003340B3 DNA binding domain
PfamPF023629.5E-10276358IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.5E-11278366IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MTSPAAAAQH PRVLLRFTHN TLVLRHRGCS VLTLKACDED CCLRELELVA QPPAGAAEAT  60
TSSWDTAHKP QFLRVFPKDF MGKMLIPAKF VQWYIPKEHL LDNHMAIVSG PLGKVSHVEL  120
QMSQSEVFFG GGWSQFLVLH DIAESNALLL RYEGNMVFTV KVFEPDGCQR ESKYKDIKMQ  180
QSINKNSGDI VGYKMLFLTP YTHRPKAQIL EIKFRCWSSL NTQLQQNPSA SSMKRKREND  240
RSRCEVQKRP KGSMTSSYKA SSKAGCIFEI GPPAWVKKEI NTCAIQNNTL YLPPVFCKAI  300
GIWEPCSITL KTSMSSTTSW QARVIPYDHS SHHVNGLKRF YQDSGIKVGD VCTFIIIETT  360
LWHVVIEPR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660966.11e-128PREDICTED: putative B3 domain-containing protein Os04g0347400
TrEMBLK3YD210.0K3YD21_SETIT; Uncharacterized protein
STRINGSi012124m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.15e-08B3 family protein